The IMPDH domain within your query sequence starts at position 1 and ends at position 319, and its E-value is 5e-122.

GKLPIVNENDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLALAGVDVVVLDSSQGNSIFQINMIKYIKEKYPSLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEAAPKIPPDIKSHSPKCPSTVSGCYMLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEG
IMPDH

IMPDH

IMP dehydrogenase / GMP reductase domain
SMART ACC:SM001240
Description:This family is involved in biosynthesis of guanosine nucleotide. Members of this family contain a TIM barrel structure. In the inosine monophosphate dehydrogenases 2 CBS domains are inserted in the TIM barrel (PMID: 10200156). This family is a member of the common phosphate binding site TIM barrel family.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 30 692 IMPDH domains in 30 689 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IMPDH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IMPDH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the IMPDH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IMPDH domain which could be assigned to a KEGG orthologous group, and not all proteins containing IMPDH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamIMPDH