The OLF domain within your query sequence starts at position 228 and ends at position 478, and its E-value is 5.43e-170.

GKLTGISDPVTVKTSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHPWSGTGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVDENGLWAVYATNQNAGNIVISKLDPVSLQILQTWNTSYPKRSAGEAFIICGTLYVTNGYSGGTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQTLYNVTLFH
OLF

OLF

Olfactomedin-like domains
SMART ACC:SM000284
Description: -
InterPro ACC:IPR003112
InterPro abstract:

The olfactomedin-like or OLF domain is a module of ~260 residues present in metazoan secreted glycoproteins with a characteristic tissue-specific expression. The domain is named after bullfrog olfactomedin, an extracellular matrix protein of olfactory neuroepithelium, whereof it forms the C-terminal part. Other proteins of the olfactomedin family contain the OLF domain in the C-terminal part … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 142 OLF domains in 6 140 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing OLF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing OLF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the OLF domain.

ProteinDescriptionDisease / phenotype
MYOC_HUMANOMIM:601652 : Glaucoma 1A, primary open angle, juvenile-onset
OMIM:137750 : Glaucoma 1A, primary open angle, recessive

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a OLF domain which could be assigned to a KEGG orthologous group, and not all proteins containing OLF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003112