The SAF domain within your query sequence starts at position 292 and ends at position 351, and its E-value is 2.38e-3.

GKSVVAKVKIPAGTTLTLDMLTVKVGEPKGYPPEDIFNLAGKKVLVTIEEDDTVMEESVE
SAF

SAF

SMART ACC:SM000858
Description:This domain family includes a range of different proteins. Such as antifreeze proteins and flagellar FlgA proteins, and CpaB pilus proteins.
InterPro ACC:IPR013974
InterPro abstract:

This entry includes a range of different proteins, such as antifreeze proteins, flagellar FlgA proteins, and CpaB pilus proteins [ PUBMED:15146494 ]. This domain adopts a β-clip fold [ PUBMED:27273476 PUBMED:31811683 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 37 399 SAF domains in 37 268 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SAF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SAF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SAF domain which could be assigned to a KEGG orthologous group, and not all proteins containing SAF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013974
PfamSAF