The Ribosomal_L14 domain within your query sequence starts at position 19 and ends at position 140, and its E-value is 2.71e-59.

GLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNAGSIA
Ribosomal_L14

Ribosomal_L14

Ribosomal protein L14p/L23e
SMART ACC:SM001374
Description: -
InterPro ACC:IPR000218
InterPro abstract:

This entry represents the large ribosomal subunit protein uL14 (formerly known as L14) from all domains of life. In eubacteria, uL14 is known to bind directly to the 23S rRNA. It belongs to a family of ribosomal proteins, which have been grouped on the basis of sequence similarities. Based on amino-acid sequence homology, it is predicted that ribosomal protein L14 is a member of a recently identified … expand

GO process:translation (GO:0006412)
GO component:ribosome (GO:0005840)
GO function:structural constituent of ribosome (GO:0003735)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 872 Ribosomal_L14 domains in 16 869 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ribosomal_L14 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ribosomal_L14 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ribosomal_L14 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ribosomal_L14 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000218
PfamRibosomal_L14