The DUF1518 domain within your query sequence starts at position 1155 and ends at position 1211, and its E-value is 7.47e-16.

GLPVQMGTPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLATRSSMV
DUF1518

DUF1518

SMART ACC:SM001151
Description:This domain, which is usually found tandemly repeated, is found various receptor co-activating proteins.
InterPro ACC:IPR010011
InterPro abstract:

This conserved domain of unknown function is usually found tandemly repeated in the nuclear receptor coactivator family (NCOA1/2/3), also known as the SRC/p160 nuclear receptor coactivator family, which are ligand-dependent transcription factors [ PUBMED:10713439 PUBMED:21854393 expand

GO component:nucleus (GO:0005634)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 581 DUF1518 domains in 1 234 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1518 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1518 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1518 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1518 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Links to other resources describing this domain

PfamDUF1518
InterProIPR010011