The DUF1744 domain within your query sequence starts at position 1524 and ends at position 1924, and its E-value is 1.9e-236.

GLSALYSSEHSLLLDKVDPKLLPPPKHTFEVRAETNLKTICRAIQRFLLAYKEERRGPTLIAVQSSWELCRLTSEIPVLEEFPLVPIRVADKISYAVLDWQRHGARRMIRHYLNLDLCLSQAFEMSRYFHIPVGNLPEDISTFGSDLFFARHLQHHNHLLWLSPTSRPDLGGKEADDNRLVMEFDDRATVEINSSGCYSTVCVELDIQNLAVNTILQSHHVNDMEGAGSMGISFDVIQQASLEDMVTGNQAASALANYDETALCSSTFRILKSMVVGWVKEITQYHNIYADNQVMHFYRWLQSPCSLLHDPALHRTLHNMMKKLFLQLIAEFKRLGSSVVYANFNRIILCTKKRRIEDALAYVEYITNSIHSKEIFHSLTISFSRCWEFLLWMDPSNYGGI
DUF1744

DUF1744

SMART ACC:SM001159
Description:This domain is found on the epsilon catalytic subunit of DNA polymerase. It is found C terminal to POLBc (SM00486).
InterPro ACC:IPR013697
InterPro abstract:

This domain is found on the catalytic subunit of DNA polymerase epsilon. It is found C-terminal to IPR006133 and IPR006134.

GO process:DNA replication (GO:0006260)
GO component:nucleus (GO:0005634)
GO function:zinc ion binding (GO:0008270), DNA-directed DNA polymerase activity (GO:0003887)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 559 DUF1744 domains in 1 558 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1744 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1744 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1744 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1744 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013697
PfamDUF1744