The RNAse_Pc domain within your query sequence starts at position 30 and ends at position 153, and its E-value is 4.83e-59.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 99141374 ) for details.

GLSRAHWFEIQHVQTSRQPCNTAMRGVNNYTQHCKQINTFLHESFQNVAATCSLHNITCKNGRKNCHESAEPVKMTDCSHTGGAYPNCRYSSDKQYKFFIVACEHPKKEDPPYQLVPVHLDKIV
RNAse_Pc

RNAse_Pc

Pancreatic ribonuclease
SMART ACC:SM000092
Description: -
InterPro ACC:IPR023412
InterPro abstract:

Pancreatic ribonucleases (RNaseA) are pyrimidine-specific endonucleases found in high quantity in the pancreas of certain mammals and of some reptiles [ PUBMED:3940901 ]. Specifically, the enzymes are involved in endonucleolytic cleavage of 3'-phosphomononucleotides and 3'-phosphooligonucleotides ending in C-P or U-P … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 376 RNAse_Pc domains in 1 365 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RNAse_Pc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RNAse_Pc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RNAse_Pc domain which could be assigned to a KEGG orthologous group, and not all proteins containing RNAse_Pc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPS00127
InterProIPR023412