The FN2 domain within your query sequence starts at position 161 and ends at position 209, and its E-value is 1.83e-27.

GNANGAVCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDKDKLFGFC
FN2

FN2

Fibronectin type 2 domain
SMART ACC:SM000059
Description:One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.
InterPro ACC:IPR000562
InterPro abstract:

Fibronectin is a multi-domain glycoprotein, found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes, that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in a number of important functions e.g., wound healing; cell adhesion; blood coagulation; cell differentiation and … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 036 FN2 domains in 4 453 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FN2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FN2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FN2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FN2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing FN2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000562
PROSITEFN2_DOMAIN
Pfamfn2