The Mterf domain within your query sequence starts at position 201 and ends at position 231, and its E-value is 7.37e-1.

GPFLTKNYAIFSEDLENLKTRVAYLQSKNFS
Mterf

Mterf

Mitochondrial termination factor repeats
SMART ACC:SM000733
Description:Human mitochondrial termination factor is a DNA-binding protein that acts as a transcription termination factor. Six repeats occur in human mTERF, that also are present in numerous plant proteins.
InterPro ACC:IPR003690
InterPro abstract:

This entry represents the mitochondrial/chloroplastic transcription termination factors (MTERFs). In humans, four MTERFs have been identified (MTERF1-4). MTERF1 was first identified as a factor responsible for terminating heavy strand transcription at a specific site at the leu-tRNA, thereby modulating the ratio of mitochondrial ribosomal RNA to mRNA [ PUBMED:2752429 expand

GO component:intracellular membrane-bounded organelle (GO:0043231)
GO function:nucleic acid binding (GO:0003676)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 39 944 Mterf domains in 7 121 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Mterf domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Mterf domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription
Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the Mterf domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Mterf domain which could be assigned to a KEGG orthologous group, and not all proteins containing Mterf domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003690