The BRIGHT domain within your query sequence starts at position 582 and ends at position 674, and its E-value is 1.7e-29.

GPNVQRLACIKKHLRSQGITMDELPLIGGCELDLACFFRLINEMGGMQQVTDLKKWNKLADMLRIPKTAQDRLAKLQEAYCQYLLSYDSLSPE
BRIGHT

BRIGHT

BRIGHT, ARID (A/T-rich interaction domain) domain
SMART ACC:SM000501
Description:DNA-binding domain containing a helix-turn-helix structure
InterPro ACC:IPR001606
InterPro abstract:

The AT-rich interaction domain (ARID) is an ~100-amino acid DNA-binding module found in a large number of eukaryotic transcription factors that regulate cell proliferation, differentiation, and development [ PUBMED:10545119 PUBMED:11867548 expand

GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 834 BRIGHT domains in 8 827 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BRIGHT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BRIGHT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BRIGHT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BRIGHT domain which could be assigned to a KEGG orthologous group, and not all proteins containing BRIGHT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001606