The RESP18 domain within your query sequence starts at position 27 and ends at position 128, and its E-value is 1.5e-51.

GQCQAGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQHVISQEMERIPRLRPPEPHPRDRSGLVPRKPGPAGELLTQGNPTGSSPAAQGFPRPAG
RESP18

RESP18

SMART ACC:SM001305
Description:This domain is found in the glucocorticoid-responsive protein regulated endocrine-specific protein 18 (RESP18) and in the N-terminal extracellular region of receptor-type tyrosine-protein phosphatases containing the protein-tyrosine phosphatase receptor IA-2 domain (PFAM: PF11548).PMID:21104147; PMID:17951542
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 858 RESP18 domains in 855 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RESP18 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RESP18 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RESP18 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RESP18 domain which could be assigned to a KEGG orthologous group, and not all proteins containing RESP18 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

PfamRESP18