The WWE domain within your query sequence starts at position 107 and ends at position 151, and its E-value is 3.9e-4.

GQGIVWEWLGDDGSWVAYEARICDYLEQQVARGIQVVDLAPLGYN
WWE

WWE

Domain in Deltex and TRIP12 homologues. Possibly involved in regulation of ubiquitin-mediated proteolysis.
SMART ACC:SM000678
Description: -
InterPro ACC:IPR018123
InterPro abstract:

The WWE domain is named after three of its conserved residues and is predicted to mediate specific protein-protein interactions in ubiquitin and ADP ribose conjugation systems. This domain is found as a tandem repeat at the N-terminal of Deltex, a cytosolic effector of Notch signalling thought to bind the N-terminal of the Notch receptor [ PUBMED:16271883 expand

GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 787 WWE domains in 1 595 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing WWE domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WWE domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription
Binding / catalysis:Unknown

Relevant references for this domain

Primary literature for the WWE domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WWE domain which could be assigned to a KEGG orthologous group, and not all proteins containing WWE domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR018123