The RUN domain within your query sequence starts at position 115 and ends at position 178, and its E-value is 7.89e-26.

GRAWLRCALNEHSLERYLHMLLADRARLSTFYEDWSFVMDEERSSMLPTMAAGLNSILFAINID
RUN

RUN

SMART ACC:SM000593
Description:domain involved in Ras-like GTPase signaling
InterPro ACC:IPR004012
InterPro abstract:

The RUN domain, named after RPIP8, unc-14 and NESCA, is organised into six conserved blocks (A-F), which constitute the 'core' of a globular structure tolerating insertions of considerable length between the conserved blocks [ PUBMED:32744243 ]. The RUN domain is found in one or two copies in several proteins that are … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 118 RUN domains in 10 051 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RUN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RUN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RUN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RUN domain which could be assigned to a KEGG orthologous group, and not all proteins containing RUN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004012