The SNc domain within your query sequence starts at position 525 and ends at position 660, and its E-value is 3.82e-45.

GRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHMDGANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAH
SNc

SNc

Staphylococcal nuclease homologues
SMART ACC:SM000318
Description: -
InterPro ACC:IPR016071
InterPro abstract:

Staphylococcus aureus nuclease (SNase) homologues, previously thought to be restricted to bacteria and archaea, are also in eukaryotes. Staphylococcal nuclease has a multi-domain organisation [ PUBMED:9003410 ]. The human cellular coactivator p100 contains four repeats, each of which is a SNase homologue. These repeats … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 17 529 SNc domains in 12 929 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SNc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SNc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SNc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SNc domain which could be assigned to a KEGG orthologous group, and not all proteins containing SNc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR016071
PfamSNase