The CASH domain within your query sequence starts at position 337 and ends at position 511, and its E-value is 7.29e-6.

GSDGERVAQTPDSSDGGLSPSGEDEDDEQLTYRLSYQVQGPRPVLGGSFLGPPLPGASIQLPSCLVLNSLHQELQKDKEAMALASSVQGCLIRKCLFRDGKGGVFVCSYGRAKMEGNVFRNLTYAVRCIHNSKIVMLRNDIYRCRASGIFLRLEGGGLIAGNNIYHNAEAGVDIR
CASH

CASH

Domain present in carbohydrate binding proteins and sugar hydrolses
SMART ACC:SM000722
Description: -
InterPro ACC:IPR006633
InterPro abstract:

The CASH domain is shared by many carbohydrate-binding proteins and sugar hydrolases. The CASH domain is characterised by internal repetitions of glycines and hydrophobic residues that correspond to the repetitive units of a predicted or observed right-handed β-helix structure of the pectate lyase superfamily. The basic structural unit of this family consists of three β-strands that form a single … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 101 CASH domains in 5 695 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CASH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CASH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CASH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CASH domain which could be assigned to a KEGG orthologous group, and not all proteins containing CASH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006633