The CUT domain within your query sequence starts at position 543 and ends at position 629, and its E-value is 5.06e-39.

GSISEGEEIDTAEIARQVKEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLTVRGKEPFHKMKQFLSDEQNILALRSIQGR
CUT

CUT

SMART ACC:SM001109
Description:The CUT domain is a DNA-binding domain often found in combination with a downstream homeodomain.
InterPro ACC:IPR003350
InterPro abstract:

The CUT domain is a DNA-binding motif which can bind independently or in cooperation with the homeodomain, often found downstream of the CUT domain. Multiple copies of the CUT domain can exist in one protein.

GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 129 CUT domains in 3 846 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CUT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CUT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport
Binding / catalysis:DNA

Relevant references for this domain

Primary literature for the CUT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CUT domain which could be assigned to a KEGG orthologous group, and not all proteins containing CUT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCUT
InterProIPR003350