The Ku78 domain within your query sequence starts at position 306 and ends at position 452, and its E-value is 2.91e-56.

GSLLLPSDTKRSLTYGTRQIVLEKEETEELKRFDEPGLILMGFKPTVMLKKQHYLRPSLFVYPEESLVSGSSTLFSALLTKCVEKEVIAVCRYTPRKNVSPYFVALVPQEEELDDQNIQVTPGGFQLVFLPYADDKRKVPFTEKVTA
Ku78

Ku78

Ku70 and Ku80 are 70kDa and 80kDa subunits of the Lupus Ku autoantigen
SMART ACC:SM000559
Description:This is a single stranded DNA- and ATP-depedent helicase that has a role in chromosome translocation. This is a domain of unknown function C-terminal to its von Willebrand factor A domain, that also occurs in bacterial hypothetical proteins.
InterPro ACC:IPR006164
InterPro abstract:

The Ku heterodimer (composed of Ku70 and Ku80) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway. This is the central DNA-binding β-barrel domain. This domain is found in both the Ku70 and Ku80 proteins that form a DNA binding heterodimer [ PUBMED:11493912 expand

GO process:double-strand break repair via nonhomologous end joining (GO:0006303)
GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 431 Ku78 domains in 6 429 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ku78 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ku78 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ku78 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ku78 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006164