The DCP2 domain within your query sequence starts at position 10 and ends at position 82, and its E-value is 5.7e-28.

GSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKADILFVAIMIVFHCF
DCP2

DCP2

Dcp2, box A domain
SMART ACC:SM001125
Description:This domain is specific to mRNA decapping protein 2 and this region has been termed Box A ((PUBMED:12218187)). Removal of the cap structure is catalysed by the Dcp1-Dcp2 complex ((PUBMED:16341225)).
InterPro ACC:IPR007722
InterPro abstract:

This presumed domain is always found to the N-terminal side of the NUDIX hydrolase domain IPR000086. This domain appears to be specific to mRNA decapping protein 2 (DCP2) P53550 and its close homologues. This region has been … expand

GO function:RNA binding (GO:0003723)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 620 DCP2 domains in 1 620 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DCP2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DCP2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the DCP2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DCP2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DCP2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR007722
PfamDCP2