The ANX domain within your query sequence starts at position 333 and ends at position 385, and its E-value is 1.03e-11.

GTDESCFNMILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTI
ANX

ANX

Annexin repeats
SMART ACC:SM000335
Description: -
InterPro ACC:IPR018502
InterPro abstract:

The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [ PUBMED:1646719 ]. The 12 annexins common to vertebrates are classified in the annexin A family and named as annexins A1-A13 (or ANXA1-ANXA13), leaving A12 unassigned in the official nomenclature. Annexins … expand

GO function:calcium ion binding (GO:0005509), calcium-dependent phospholipid binding (GO:0005544)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 33 454 ANX domains in 9 551 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ANX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ANX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ANX domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ANX domain which could be assigned to a KEGG orthologous group, and not all proteins containing ANX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamannexin
InterProIPR018502
PROSITEANNEXIN