The BAG domain within your query sequence starts at position 426 and ends at position 503, and its E-value is 9.22e-27.

GVLKVEAILEKVQGLEQAVDSFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKA
BAG

BAG

BAG domains, present in regulator of Hsp70 proteins
SMART ACC:SM000264
Description:BAG domains, present in Bcl-2-associated athanogene 1 and silencer of death domains
InterPro ACC:IPR003103
InterPro abstract:

BAG domains are present in Bcl-2-associated athanogene 1 and silencer of death domains. The BAG proteins are modulators of chaperone activity; they bind to HSP70/HSC70 proteins and promote substrate release. The proteins have anti-apoptotic activity and increase the anti-cell death function of BCL-2 induced by various stimuli. BAG-1 binds to the serine/threonine kinase Raf-1 or Hsc70/Hsp70 in … expand

GO function:protein-folding chaperone binding (GO:0051087)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 121 BAG domains in 1 284 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BAG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BAG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BAG domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BAG domain which could be assigned to a KEGG orthologous group, and not all proteins containing BAG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003103