The SWAP domain within your query sequence starts at position 209 and ends at position 262, and its E-value is 3.94e-19.

HAIIERTANFVCKQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKE
SWAP

SWAP

Suppressor-of-White-APricot splicing regulator
SMART ACC:SM000648
Description:domain present in regulators which are responsible for pre-mRNA splicing processes
InterPro ACC:IPR000061
InterPro abstract:

SWAP is derived from the Suppressor-of-White-APricot splicing regulator from Drosophila melanogaster. The domain is found in regulators responsible for pervasive, nonsex-specific alternative pre-mRNA splicing characteristics and has been found in splicing regulatory proteins [ PUBMED:8206918 ]. These ancient, conserved … expand

GO process:RNA processing (GO:0006396)
GO function:RNA binding (GO:0003723)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 632 SWAP domains in 6 348 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SWAP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SWAP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:RNA-binding

Relevant references for this domain

Primary literature for the SWAP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SWAP domain which could be assigned to a KEGG orthologous group, and not all proteins containing SWAP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSurp
InterProIPR000061