The WNT1 domain within your query sequence starts at position 38 and ends at position 351, and its E-value is 1.02e-185.

HAWSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCS
WNT1

WNT1

found in Wnt-1
SMART ACC:SM000097
Description: -
InterPro ACC:IPR005817
InterPro abstract:

Wnt proteins constitute a large family of secreted molecules that are involved in intercellular signalling during development. The name derives from the first 2 members of the family to be discovered: int-1 (mouse) and wingless (Drosophila) [ PUBMED:9891778 ]. It is now recognised that Wnt signalling controls many cell … expand

GO process:Wnt signaling pathway (GO:0016055), multicellular organism development (GO:0007275)
GO component:extracellular region (GO:0005576)
GO function:signaling receptor binding (GO:0005102)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 17 523 WNT1 domains in 17 515 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing WNT1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WNT1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the WNT1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WNT1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing WNT1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005817