The PP2Cc domain within your query sequence starts at position 96 and ends at position 518, and its E-value is 1.1e-92.

HKVLDFNNGVPNSVLRFESNQLAANSPVEDRQGVATCVQTNGMMFGIFDGHGGHACAQAVSERLFYYMAVSLMSHQTLEQMEEATENMKPLLPILRWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVNGVHLHVANAGDCRAILGVQEENGAWSCLPLTCDHNAWNEAELSRLKREHPESEDRTLIIDDRLLGVLMPCRAFGDVQLKWSKELQRNVLARGFDTEALNIYQFTPPHYYTPPYLTAKPEVTYHRLRRQDKFLVLASDGLWDMLGNEDVVRLVVGHLSKVGRHKPDLDQRPANLGLMQSLLLQRKASGLHAADQNTATHLIRHAIGSNEYGEMEPERLAAMLTLPEDVARMYRDDITVMVV
PP2Cc

PP2Cc

Serine/threonine phosphatases, family 2C, catalytic domain
SMART ACC:SM000332
Description:The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 66 722 PP2Cc domains in 66 644 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PP2Cc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PP2Cc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein phosphatase, serine-specific phosphatase, threonine-specific phosphatase

Relevant references for this domain

Primary literature for the PP2Cc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PP2Cc domain which could be assigned to a KEGG orthologous group, and not all proteins containing PP2Cc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPP2C
PROSITEPP2C