The DysFN domain within your query sequence starts at position 948 and ends at position 1004, and its E-value is 2.65e-22.

HLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTD
DysFN

DysFN

Dysferlin domain, N-terminal region.
SMART ACC:SM000693
Description:Domain of unknown function present in yeast peroxisomal proteins, dysferlin, myoferlin and hypothetical proteins. Due to an insertion of a dysferlin domain within a second dysferlin domain we have chosen to predict these domains in two parts: the N-terminal region and the C-terminal region.
InterPro ACC:IPR006614
InterPro abstract:

These two closely linked domains are found in ferlin gene family members and in peroxisomal membrane proteins (peroxins). The function of the domains is unknown.

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 167 DysFN domains in 2 207 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DysFN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DysFN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the DysFN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DysFN domain which could be assigned to a KEGG orthologous group, and not all proteins containing DysFN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006614