The VHP domain within your query sequence starts at position 538 and ends at position 573, and its E-value is 2.34e-19.

HLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF
VHP

VHP

Villin headpiece domain
SMART ACC:SM000153
Description: -
InterPro ACC:IPR003128
InterPro abstract:

Villin is an F-actin bundling protein involved in the maintenance of the microvilli of the absorptive epithelia. The villin-type "headpiece" domain is a modular motif found at the extreme C terminus of larger "core" domains in over 25 cytoskeletal proteins in plants and animals, often in assocation with the Gelsolin repeat. Although the headpiece is classified as an F-actin-binding … expand

GO process:cytoskeleton organization (GO:0007010)
GO function:actin binding (GO:0003779)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 527 VHP domains in 6 527 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing VHP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing VHP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Actin-binding

Relevant references for this domain

Primary literature for the VHP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a VHP domain which could be assigned to a KEGG orthologous group, and not all proteins containing VHP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003128