The ZnF_C2C2 domain within your query sequence starts at position 84 and ends at position 125, and its E-value is 2.18e-11.

HPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
ZnF_C2C2

ZnF_C2C2

C2C2 Zinc finger
SMART ACC:SM000440
Description:Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
InterPro ACC:IPR001222
InterPro abstract:

Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a … expand

GO process:DNA-templated transcription (GO:0006351)
GO function:zinc ion binding (GO:0008270), nucleic acid binding (GO:0003676)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 547 ZnF_C2C2 domains in 7 538 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_C2C2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_C2C2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_C2C2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_C2C2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_C2C2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001222