The KR domain within your query sequence starts at position 302 and ends at position 384, and its E-value is 3.94e-45.

HQCYNGSGADYRGMASTTKSGHQCQPWALQHPHSHRLSSTEFPELGGGHAYCRNPGGQVEGPWCFTQNKNVRVELCDVPPCSP
KR

KR

Kringle domain
SMART ACC:SM000130
Description:Named after a Danish pastry. Found in several serine proteases and in ROR-like receptors. Can occur in up to 38 copies (in apolipoprotein(a)). Plasminogen-like kringles possess affinity for free lysine and lysine- containing peptides.
InterPro ACC:IPR000001
InterPro abstract:

Kringles are autonomous structural domains, found throughout the blood clotting and fibrinolytic proteins. Kringle domains are believed to play a role in binding mediators (e.g., membranes, other proteins or phospholipids), and in the regulation of proteolytic activity [ PUBMED:3886654 PUBMED:6373375 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 009 KR domains in 7 555 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the KR domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the KR domain.

ProteinDescriptionDisease / phenotype
APOA_HUMANOMIM:152200 : {Coronary artery disease, susceptibility to}

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KR domain which could be assigned to a KEGG orthologous group, and not all proteins containing KR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamkringle
InterProIPR000001
PROSITEKR_DOMAIN