The RA domain within your query sequence starts at position 188 and ends at position 278, and its E-value is 2.67e-9.

HVYDHETSIFTPTFGSETKVRANSIMRTEEVIKQLLQKFKIENSPRDFALYIIFGTGEQRKLKKTDVPLLQRLLQGPSKSNARIFLMDKDA
RA

RA

Ras association (RalGDS/AF-6) domain
SMART ACC:SM000314
Description:RasGTP effectors (in cases of AF6, canoe and RalGDS); putative RasGTP effectors in other cases. Kalhammer et al. have shown that not all RA domains bind RasGTP. Predicted structure similar to that determined, and that of the RasGTP-binding domain of Raf kinase. Predicted RA domains in PLC210 and nore1 found to bind RasGTP. Included outliers (Grb7, Grb14, adenylyl cyclases etc.)
InterPro ACC:IPR000159
InterPro abstract:

Ras proteins are signal-transducing GTPases that cycle between inactive GDP-bound and active GTP-bound forms. Ras is a prolific signalling molecule interacting with a spectrum of effector molecules and acting through more than one signalling pathway. A domain of about 100 residues, termed RA for RalGDS/AF-6 or Ras-Associating, interacts with Ras and other small GTPases. It occurs in one or two … expand

GO process:signal transduction (GO:0007165)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 20 447 RA domains in 18 300 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:RasGTP

Relevant references for this domain

Primary literature for the RA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RA domain which could be assigned to a KEGG orthologous group, and not all proteins containing RA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRA
InterProIPR000159