The MAGE_N domain within your query sequence starts at position 8 and ends at position 87, and its E-value is 4.74e0.

HYCSLQGSARSQRELDNVQATIAVVDEEEATPTSKKVYSSGIPSPPQSPQRASSPLVILASVPEGPSEEASTNQVEEQED
MAGE_N

MAGE_N

Melanoma associated antigen family N terminal
SMART ACC:SM001392
Description:This domain family is found in eukaryotes, and is typically between 82 and 96 amino acids in length. This family is the N terminal of various melanoma associated antigens. These are tumor rejection antigens which are expressed on HLA-A1 of tumor cells and they are recognized by cytotoxic T lymphocytes (CTLs).
InterPro ACC:IPR021072
InterPro abstract:

This domain is found N-terminal in various melanoma associated antigens from eukaryotes, and is typically between 82 and 96 amino acids in length. These are tumour rejection antigens which are expressed on HLA-A1 of tumour cells and they are recognised by cytotoxic T lymphocytes (CTLs) [ PUBMED:7642112 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 336 MAGE_N domains in 2 261 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MAGE_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MAGE_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MAGE_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MAGE_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing MAGE_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

PfamMAGE_N
InterProIPR021072