The TFS2N domain within your query sequence starts at position 7 and ends at position 81, and its E-value is 2.51e-25.

IARIARRLDKMVTRKNAEGAMDLLRELKNMPITLHLLQSTRVGMSVNALRKQSSDEELIALAKSLIKSWKKLLDV
TFS2N

TFS2N

Domain in the N-terminus of transcription elongation factor S-II (and elsewhere)
SMART ACC:SM000509
Description: -
InterPro ACC:IPR003617
InterPro abstract:

Transcription factor S-II (TFIIS) induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites. It is widely distributed being found in mammals, Drosophila, yeast and in the archaebacteria Sulfolobus acidocaldarius [ PUBMED:8502569 ]. S-II proteins have … expand

GO component:nucleus (GO:0005634)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 953 TFS2N domains in 1 898 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TFS2N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TFS2N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TFS2N domain which could be assigned to a KEGG orthologous group, and not all proteins containing TFS2N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003617