The R3H domain within your query sequence starts at position 107 and ends at position 184, and its E-value is 3.18e-22.

IDLHEFLVNTLKNNPRDRMMLLKLEQEILDFIGNNESPRKKFPPMTSYHRMLLHRVAAYFGLDHNVDQSGKSVIVNKT
R3H

R3H

Putative single-stranded nucleic acids-binding domain
SMART ACC:SM000393
Description: -
InterPro ACC:IPR001374
InterPro abstract:

The R3H domain is a conserved sequence motif found in proteins from a diverse range of organisms including eubacteria, green plants, fungi and various groups of metazoans, but not in archaea and Escherichia coli. The domain is named R3H because it contains an invariant arginine and a highly conserved histidine, that are separated by three residues. It also displays a conserved pattern of hydrophobic … expand

GO function:nucleic acid binding (GO:0003676)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 310 R3H domains in 10 308 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing R3H domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing R3H domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Single-stranded nucleic acids

Relevant references for this domain

Primary literature for the R3H domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a R3H domain which could be assigned to a KEGG orthologous group, and not all proteins containing R3H domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamR3H
InterProIPR001374