The HX domain within your query sequence starts at position 439 and ends at position 485, and its E-value is 1.86e-14.

IDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITIWKGIPE
HX

HX

Hemopexin-like repeats.
SMART ACC:SM000120
Description:Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs).
InterPro ACC:IPR018487
InterPro abstract:

Hemopexin ( EC:3.2.1.35 ) is a serum glycoprotein that binds haem and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation [ PUBMED:12042069 ]. Hemopexin prevents haem-mediated oxidative … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 32 767 HX domains in 8 777 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the HX domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HX domain which could be assigned to a KEGG orthologous group, and not all proteins containing HX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamhemopexin
PROSITEHX_DOMAIN
InterProIPR018487