The FN3 domain within your query sequence starts at position 531 and ends at position 608, and its E-value is 2.64e-10.

IDSPENLVTDRVTENSLSVSWDPVEADIDRYVVSYTSVDGETKQVPVKKDQRSTVLTGLSPGVEYKVYVWAEKGDRES
FN3

FN3

Fibronectin type 3 domain
SMART ACC:SM000060
Description:One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
InterPro ACC:IPR003961
InterPro abstract:

Fibronectin is a dimeric glycoprotein composed of disulfide-linked subunitswith a molecular weight of 220-250kDa each. It is involved in cell adhesion,cell morphology, thrombosis, cell migration, and embryonic differentiation. Fibronectin is a modular protein composed of homologous repeats of threeprototypical types of domains known as types I, II, and III [ PUBMED:6218503 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 647 694 FN3 domains in 183 810 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FN3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FN3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FN3 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the FN3 domain.

ProteinDescriptionDisease / phenotype
CO7A1_HUMANOMIM:120120 : Epidermolysis bullosa dystrophica, dominant
OMIM:131750 : Epidermolysis bullosa dystrophica, recessive
OMIM:226600 : Epidermolysis bullosa, pretibial, dominant and recessive
OMIM:131850 : no description
L1CAM_HUMANOMIM:308840 : Hydrocephalus due to aqueductal stenosis
OMIM:307000 : MASA syndrome
OMIM:303350 : Spastic paraplegia
OMIM:312900 : no description
ITB4_HUMANOMIM:147557 : Epidermolysis bullosa, junctional, with pyloric atresia
OMIM:226730 : Epidermolysis bullosa, generalized atrophic benign
OMIM:226650 : no description
LEPR_HUMANOMIM:601007 : LEPTIN RECEPTOR; LEPR
KALM_HUMANOMIM:308700 : Kallmann syndrome
INSR_HUMANOMIM:147670 : Leprechaunism
OMIM:246200 : Rabson-Mendenhall syndrome
OMIM:262190 : Diabetes mellitus, insulin-resistant, with acanthosis nigricans
IL2RG_HUMANOMIM:308380 : Severe combined immunodeficiency, X-linked
OMIM:300400 : Combined immunodeficiency, X-linked, moderate
OMIM:312863 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FN3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing FN3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamfn3
InterProIPR003961
PROSITEFN3_DOMAIN