The TFIIE domain within your query sequence starts at position 28 and ends at position 175, and its E-value is 2.69e-74.

IEHVLALDILIRNPCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERNSTNRASFKCPVCCSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDART
TFIIE

TFIIE

Transcription initiation factor IIE
SMART ACC:SM000531
Description: -
InterPro ACC:IPR002853
InterPro abstract:

This entry represents the conserved N-terminal region of eukaryotic TFIIE-alpha and proteins from archaebacteria (TFE) that are also presumed to be TFIIE-alpha subunits [ PUBMED:9389475 ].

Initiation of eukaryotic mRNA transcription requires melting of promoter DNA with the help of the general transcription … expand

GO process:transcription initiation at RNA polymerase II promoter (GO:0006367)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 838 TFIIE domains in 838 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TFIIE domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TFIIE domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TFIIE domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TFIIE domain which could be assigned to a KEGG orthologous group, and not all proteins containing TFIIE domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002853
PfamTFIIE