The Enolase_N domain within your query sequence starts at position 3 and ends at position 91, and its E-value is 8e-52.

IEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKAKFGANAILGVSLAVCKAGAAERDLPLYRHI
Enolase_N

Enolase_N

Enolase, N-terminal domain
SMART ACC:SM001193
Description: -
InterPro ACC:IPR020811
InterPro abstract:

Enolase (2-phospho-D-glycerate hydrolase) is an essential, homodimeric enzyme that catalyses the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways [ PUBMED:1859865 PUBMED:1840492 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 26 121 Enolase_N domains in 26 119 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Enolase_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Enolase_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Enolase_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing Enolase_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamEnolase_N
InterProIPR020811