The DUF3452 domain within your query sequence starts at position 97 and ends at position 223, and its E-value is 4.59e-25.

IFIAAVDLDEMPFTFTELQKSIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSALSTEINSMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVVDYFIKF
DUF3452

DUF3452

Domain of unknown function (DUF3452)
SMART ACC:SM001367
Description:This domain is functionally uncharacterised. This domain is found in bacteria and eukaryotes.
InterPro ACC:IPR024599
InterPro abstract:

This domain is found in N-terminal of the retinoblastoma-associated protein. It is found in association with IPR002720 and IPR002719. This domain is typically between 124 to 150 amino acids in length and has a single completely … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 723 DUF3452 domains in 1 722 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF3452 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF3452 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF3452 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF3452 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF3452
InterProIPR024599