The Sorb domain within your query sequence starts at position 6 and ends at position 56, and its E-value is 9.63e-34.

IKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDEDTDM
Sorb

Sorb

Sorbin homologous domain
SMART ACC:SM000459
Description:First found in the peptide hormone sorbin and later in the ponsin/ArgBP2/vinexin family of proteins.
InterPro ACC:IPR003127
InterPro abstract:

Sorbin is an active peptide present in the digestive tract, where it has pro-absorptive and anti-secretory effects in different parts of the intestine, including the ability to decrease VIP (vasoactive intestinal peptide) and cholera toxin-induced secretion. It is expressed in some intestinal and pancreatic endocrine tumours in humans [ PUBMED:10704721 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 291 Sorb domains in 4 287 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Sorb domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Sorb domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Sorb domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Sorb domain which could be assigned to a KEGG orthologous group, and not all proteins containing Sorb domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

InterProIPR003127