The FDF domain within your query sequence starts at position 247 and ends at position 350, and its E-value is 3.37e-32.

IKFEGDFDFESANAQFNREELDKEFKKKLNFKDDKADKGEEKDPAVMAQSEETAAEEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSG
FDF

FDF

SMART ACC:SM001199
Description:The FDF domain, so called because of the conserved FDF at its N termini, is an entirely alpha-helical domain with multiple exposed hydrophilic loops. It is found at the C terminus of Scd6p-like SM domains. It is also found with other divergent Sm domains and in proteins such as Dcp3p and FLJ21128, where it is found N terminal to the YjeF-N domain, a novel Rossmann fold domain PMID 15257761.
InterPro ACC:IPR019050
InterPro abstract:

The FDF domain, so called because of the conserved FDF at its N termini, is an entirely α-helical domain with multiple exposed hydrophilic loops [ PUBMED:15257761 ]. It is found at the C terminus of Scd6p-like SM domains [ PUBMED:15257761 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 917 FDF domains in 3 915 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FDF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FDF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the FDF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FDF domain which could be assigned to a KEGG orthologous group, and not all proteins containing FDF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFDF
InterProIPR019050