The TPR domain within your query sequence starts at position 272 and ends at position 305, and its E-value is 5.78e-1.

IKIMQNIGITFIKTGQYSDAINSFEHIMSMAPSL
TPR

TPR

Tetratricopeptide repeats
SMART ACC:SM000028
Description:Repeats present in 4 or more copies in proteins. Contain a minimum of 34 amino acids each and self-associate via a "knobs and holes" mechanism.
InterPro ACC:IPR019734
InterPro abstract:

The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [ PUBMED:7667876 PUBMED:9482716 PUBMED:1882418 ]. It mediates protein-protein … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 309 452 TPR domains in 257 843 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TPR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TPR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein-binding

Relevant references for this domain

Primary literature for the TPR domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the TPR domain.

ProteinDescriptionDisease / phenotype
NCF2_HUMANOMIM:233710 : Chronic granulomatous disease due to deficiency of NCF-2
PEX5_HUMANOMIM:600414 : Adrenoleukodystrophy, neonatal
OMIM:202370 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TPR domain which could be assigned to a KEGG orthologous group, and not all proteins containing TPR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019734
PfamTPR