The PreSET domain within your query sequence starts at position 697 and ends at position 804, and its E-value is 1.75e-41.

ILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQVNPNSGYQYKRLEECLPTGVYECNKRCN
PreSET

PreSET

N-terminal to some SET domains
SMART ACC:SM000468
Description:A Cys-rich putative Zn2+-binding domain that occurs N-terminal to some SET domains. Function is unknown. Unpublished.
InterPro ACC:IPR007728
InterPro abstract:

This region is found in a number of histone lysine methyltransferases (HMTase), N-terminal to the SET domain; it is generally described as the pre-SET domain.

Histone lysine methylation is part of the histone code that regulated chromatin function and epigenetic control of gene function. Histone lysine methyltransferases (HMTase) differ both in their substrate specificity for the various … expand

GO component:nucleus (GO:0005634)
GO function:zinc ion binding (GO:0008270), histone methyltransferase activity (GO:0042054)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 385 PreSET domains in 1 382 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PreSET domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PreSET domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PreSET domain which could be assigned to a KEGG orthologous group, and not all proteins containing PreSET domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR007728