The PADR1 domain within your query sequence starts at position 280 and ends at position 333, and its E-value is 1.48e-28.

ILDRVADGMAFGALLPCKECSGQLVFKSDAYYCTGDVTAWTKCMVKTQNPSRKE
PADR1

PADR1

SMART ACC:SM001335
Description:This domain is found in poly(ADP-ribose)-synthetases (PMID:15112237). The function of this domain is unknown.
GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 059 PADR1 domains in 1 055 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PADR1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PADR1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PADR1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PADR1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing PADR1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPADR1