The MutL_C domain within your query sequence starts at position 277 and ends at position 421, and its E-value is 1.59e-36.

ILGQFNLGFIVTKLKEDLFLVDQHAADEKYNFEMLQQHTVLQAQRLITPQTLNLTAVNEAVLIENLEIFRKNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLSDSPGVMCRPSRVRQMFASRACRKSVMIGTAL
MutL_C

MutL_C

MutL C terminal dimerisation domain
SMART ACC:SM000853
Description:MutL and MutS are key components of the DNA repair machinery that corrects replication errors. MutS recognises mispaired or unpaired bases in a DNA duplex and in the presence of ATP, recruits MutL to form a DNA signaling complex for repair. The N terminal region of MutL contains the ATPase domain and the C terminal is involved in dimerisation.
InterPro ACC:IPR014790
InterPro abstract:

MutL and MutS are key components of the DNA repair machinery that corrects replication errors [ PUBMED:8811176 ]. MutS recognises mispaired or unpaired bases in a DNA duplex and in the presence of ATP, recruits MutL to form a DNA signalling complex for repair. The N-terminal region of MutL contains the ATPase domain and … expand

GO process:mismatch repair (GO:0006298)
GO function:ATP binding (GO:0005524)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 20 111 MutL_C domains in 20 108 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MutL_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MutL_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the MutL_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MutL_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing MutL_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMutL_C
InterProIPR014790