The WW domain within your query sequence starts at position 18 and ends at position 50, and its E-value is 1.39e-11.

ILPPGWHSYLSPQGRRYYVNTTTNETTWERPSS
WW

WW

Domain with 2 conserved Trp (W) residues
SMART ACC:SM000456
Description:Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides.
InterPro ACC:IPR001202
InterPro abstract:

The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded β-sheet. This short domain of approximately 40 amino acids, may be repeated up to four times in some proteins [ PUBMED:7846762 PUBMED:7802651 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 67 566 WW domains in 38 399 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing WW domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WW domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Interaction (with the environment)
Binding / catalysis:Protein-binding, polyproline-binding

Relevant references for this domain

Primary literature for the WW domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WW domain which could be assigned to a KEGG orthologous group, and not all proteins containing WW domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEWW_DOMAIN_2
InterProIPR001202
PfamWW_rsp5_WWP