The DHHA2 domain within your query sequence starts at position 208 and ends at position 351, and its E-value is 8.32e-17.

INVLQESQLSAQGLSLEQTMLKDLKELSDGEIKVAISTVNMTLEDYLLHGNITSDLKAFTDKFGFDVLILISSFTWEEQQRQQIAVYSQNLELCSQICCELEESQNPCLELEPFECGCDEILVYQQEDPSVTSDQVFLLLKEVI
DHHA2

DHHA2

SMART ACC:SM001131
Description:This domain is often found adjacent to the DHH domain PF01368 and is called DHHA2 for DHH associated domain. This domain is diagnostic of DHH subfamily 2 members ((PUBMED:9478130)). The domain is about 120 residues long and contains a conserved DXK motif at its amino terminus.
InterPro ACC:IPR004097
InterPro abstract:

This domain is called DHHA2 since it is often associated with the DHH domain ( IPR001667 ) and is diagnostic of DHH subfamily 2 members [ PUBMED:9478130 ]. The domain is about 120 residues long and contains a conserved DXK motif at its … expand

GO component:cytoplasm (GO:0005737)
GO function:pyrophosphatase activity (GO:0016462)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 950 DHHA2 domains in 6 949 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DHHA2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DHHA2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DHHA2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DHHA2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DHHA2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDHHA2
InterProIPR004097