The PWWP domain within your query sequence starts at position 278 and ends at position 329, and its E-value is 1.96e-21.

IPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDIT
PWWP

PWWP

domain with conserved PWWP motif
SMART ACC:SM000293
Description:conservation of Pro-Trp-Trp-Pro residues
InterPro ACC:IPR000313
InterPro abstract:

The PWWP domain is an around 70 amino acids domain that was named after its central core 'Pro-Trp-Trp-Pro'. The PWWP domain is found in one or, less frequently, in two copies in nuclear, often DNA-binding proteins that function as transcription factors regulating developmental processes. Due to its position, the composition of amino acids close to the PWWP motif and the pattern of other domains … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 446 PWWP domains in 6 224 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PWWP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PWWP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PWWP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PWWP domain which could be assigned to a KEGG orthologous group, and not all proteins containing PWWP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000313
PfamPWWP