The LU domain within your query sequence starts at position 23 and ends at position 121, and its E-value is 2.5e-4.

IQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASAI
LU

LU

Ly-6 antigen / uPA receptor -like domain
SMART ACC:SM000134
Description:Three-fold repeated domain in urokinase-type plasminogen activator receptor; occurs singly in other GPI-linked cell-surface glycoproteins (Ly-6 family, CD59, thymocyte B cell antigen, Sgp-2). Topology of these domains is similar to that of snake venom neurotoxins.
InterPro ACC:IPR016054
InterPro abstract:

This entry represents a three-fold repeated domain that is found in a number of venomous neuro- and cytotoxins from snakes [ PUBMED:23881252 ] as well as in cell receptors such as urokinase-type plasminogen activator receptor (uPAR) that occurs singly in other GPI-linked cell-surface glycoproteins (Ly-6 family, CD59). … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 680 LU domains in 4 879 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LU domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LU domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LU domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LU domain which could be assigned to a KEGG orthologous group, and not all proteins containing LU domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamUPAR_LY6
PROSITELU_DOMAIN
InterProIPR016054