The E2_bind domain within your query sequence starts at position 360 and ends at position 448, and its E-value is 1.02e-40.

IQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFT
E2_bind

E2_bind

SMART ACC:SM001181
Description:E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades. This is an E2 binding domain that is found on NEDD8 activating E1 enzyme. The domain resembles ubiquitin, and recruits the catalytic core of the E2 enzyme Ubc12 in a similar manner to that in which ubiquitin interacts with ubiquitin binding domains (PUBMED:15694336).
InterPro ACC:IPR014929
InterPro abstract:

E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades. This is an E2 binding domain that is found on NEDD8 activating E1 enzyme. The protein resembles ubiquitin, and recruits the catalytic core of the E2 enzyme Ubc12 in a similar manner to that in which ubiquitin interacts with ubiquitin binding domains [ PUBMED:15694336 expand

GO process:protein neddylation (GO:0045116)
GO function:NEDD8 activating enzyme activity (GO:0019781)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 533 E2_bind domains in 1 532 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing E2_bind domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing E2_bind domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the E2_bind domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a E2_bind domain which could be assigned to a KEGG orthologous group, and not all proteins containing E2_bind domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014929
PfamE2_bind