The Malic_M domain within your query sequence starts at position 36 and ends at position 288, and its E-value is 5.68e-115.

IQGTASVAVAGILAALRITKNRLSNHVFVFQGAGEAAMGIAHLLVMALEKEGIPKTEAIKKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIVFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGRTFTPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAVKVLDYAY
Malic_M

Malic_M

Malic enzyme, NAD binding domain
SMART ACC:SM000919
Description:Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate.
InterPro ACC:IPR012302
InterPro abstract:

This entry represents the NAD-binding domain of malic enzymes.

Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate, a reaction important in a number of metabolic pathways - e.g. carbon dioxide released from the reaction may be used in sugar production during the Calvin cycle of photosynthesis [ PUBMED:8300616 expand

GO function:NAD binding (GO:0051287)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 29 545 Malic_M domains in 29 523 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Malic_M domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Malic_M domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Malic_M domain which could be assigned to a KEGG orthologous group, and not all proteins containing Malic_M domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMalic_M
InterProIPR012302