The PBD domain within your query sequence starts at position 30 and ends at position 66, and its E-value is 2.93e-6.

ISPPLGDFRHTIHIGSGGGDDMFGDISFLQGKFHLLP
PBD

PBD

P21-Rho-binding domain
SMART ACC:SM000285
Description:Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also known as the Cdc42/Rac interactive binding (CRIB).
InterPro ACC:IPR000095
InterPro abstract:

This entry represents the CRIB domain.

Many putative downstream effectors of the small GTPases Cdc42 and Rac contain a GTPase binding domain (GBD), also called p21 binding domain (PBD), which has been shown to specifically bind the GTP bound form of Cdc42 or Rac, with a preference for Cdc42 [ PUBMED:8107774 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 112 PBD domains in 8 652 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PBD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PBD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Cdc42p-binding, Rho-GTPase-binding

Relevant references for this domain

Primary literature for the PBD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PBD domain which could be assigned to a KEGG orthologous group, and not all proteins containing PBD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPBD
InterProIPR000095