The Agenet domain within your query sequence starts at position 11 and ends at position 73, and its E-value is 3.53e0.

ITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLERPAL

Agenet Tudor-like domain present in plant sequences.
SMART ACC:	SM000743
Description:	Domain in plant sequences with possible chromatin-associated functions.
InterPro ACC:	IPR014002
InterPro abstract:	This entry represents an agenet domain found in EMSY-like (AtEML) proteins, which have possible roles in chromatin regulation and are related to the BRCA2-interacting human oncoprotein EMSY [ PUBMED:21830950 ]. Proteins containing this domain also include MRG2 (AT1G02740) from Arabidopsis and PHD finger protein 20-like … expand This entry represents an agenet domain found in EMSY-like (AtEML) proteins, which have possible roles in chromatin regulation and are related to the BRCA2-interacting human oncoprotein EMSY [ PUBMED:21830950 ]. Proteins containing this domain also include MRG2 (AT1G02740) from Arabidopsis and PHD finger protein 20-like protein 1 (PHF20L1) from animals. MRG2 binds to the FLOWERING LOCUS T locus and elevates the expression in an H3K36me3-dependent manner [ PUBMED:25183522 ]. The function of PHF20L1 is not clear. collapse
Family alignment:	View the Family alignment or the Alignment consensus sequence
There are 8 129 Agenet domains in 3 554 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Agenet domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Agenet domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:	Transport

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Agenet domain which could be assigned to a KEGG orthologous group, and not all proteins containing Agenet domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterPro	IPR014002